PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_12850_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 171aa    MW: 19408 Da    PI: 9.8579
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_12850_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP104.29.3e-331086177
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                    +Cqv+gC++dl++a++y+rrhkvC +h+ +pv++v+++++rfCqqCs+ h+ s fD +++sCr  La+hn+rrrk++
  Neem_12850_f_1 10 VCQVDGCNVDLKDANDYYRRHKVCVTHAMSPVIFVDNERRRFCQQCSKLHHPSLFDAARKSCRYSLASHNARRRKNA 86
                    6**************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.4E-26772IPR004333Transcription factor, SBP-box
PROSITE profilePS5114126.051885IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.36E-30987IPR004333Transcription factor, SBP-box
PfamPF031106.1E-271184IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MEMRPDRSYV CQVDGCNVDL KDANDYYRRH KVCVTHAMSP VIFVDNERRR FCQQCSKLHH  60
PSLFDAARKS CRYSLASHNA RRRKNAARDK ELHRPAVRAA VAAANNLKQD HRTVQTNYPN  120
YSSLSVESSP SLSNNILANP MIPPPPPPAA ISESSGSRQI FPEITRPYFL V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2310841084squamosa promoter binding protein-like 4
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.12e-21squamosa promoter binding protein-like 5